PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT02956
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family NF-YA
Protein Properties Length: 402aa    MW: 44561.4 Da    PI: 10.2022
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT02956genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA103.81.6e-32108164158
  CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                dep++VN+KQy++Il+RRq Rakle+++kl +k+rkpylheSRh hA++R+RgsgGrF
   EMT02956 108 DEPIFVNPKQYNGILRRRQLRAKLEAQNKL-TKNRKPYLHESRHLHAMKRARGSGGRF 164
                79****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005212.6E-37106167IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115237.727107167IPR001289Nuclear transcription factor Y subunit A
PfamPF020451.9E-28109164IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006165.7E-22110132IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006165.7E-22141164IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 402 aa     Download sequence    Send to blast
MNRQHCDVVL DLQLRPILSS GDSFGKSVDD HMRSTLTFGD KHSVFASQNT DYGHPMACIS  60
YPFNDSGSVW AAYGSRAMLY MEQFQPLMAG GGASATARVP LPVELAADEP IFVNPKQYNG  120
ILRRRQLRAK LEAQNKLTKN RKPYLHESRH LHAMKRARGS GGRFLNSKQL KQQQQQSGSA  180
CTKAIADGAN SLGSTHLRLG SGAAGDRSNS ASKAMSSQEN SKRVAAPAPA FTMIQAARKD  240
DDFFHHHGHH LSFSGHFGQS SDRPHSSLLD VRHANVGVLI KGAHSTRNWA GQFLEPRYQE  300
SLASTGMKLK VAQRLTRYEQ SNRPFAFFAL VTSAIQIRGC SEDRELNLWN KDLLVPFISV  360
LFTSSPGGRV IGCNGARDKE RMFNLNYIYM GYDVEVVNML QM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A6e-20108169263NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0089360.0BT008936.1 Triticum aestivum clone wdi1c.pk002.b10:fis, full insert mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003570525.11e-117PREDICTED: nuclear transcription factor Y subunit A-4 isoform X1
TrEMBLR7W5V30.0R7W5V3_AEGTA; Nuclear transcription factor Y subunit A-5
STRINGMLOC_36554.11e-133(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP132762833
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G54160.12e-34nuclear factor Y, subunit A5